PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G113900.1
Common NameB456_007G113900, LOC105802855
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB_related
Protein Properties Length: 730aa    MW: 80167 Da    PI: 6.6253
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G113900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.64.4e-162468147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        r rWT+eE+ ++++a k++G   W +I +++g ++t+ q++s+ qk+
  Gorai.007G113900.1 24 RERWTEEEHNRFLEALKLYGRA-WQRIEEHIG-TKTAVQIRSHAQKF 68
                        78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.91E-171874IPR009057Homeodomain-like
PROSITE profilePS5129421.0911973IPR017930Myb domain
TIGRFAMsTIGR015577.9E-172271IPR006447Myb domain, plants
SMARTSM007177.3E-132371IPR001005SANT/Myb domain
PfamPF002493.0E-132467IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-82464IPR009057Homeodomain-like
CDDcd001671.38E-92669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 730 aa     Download sequence    Send to blast
MDAYSSGEEL LIKTRKPYTI TKQRERWTEE EHNRFLEALK LYGRAWQRIE EHIGTKTAVQ  60
IRSHAQKFFS KLEKEALTKG IPTGQALDIE IPPPRPKRKP RNPYPRKMSA ATSVQMGAKD  120
GKSETPVSSL HCKQAFNLEK EPLPERSSRD EKSSNLKEIL DDNCSEVFTL LHEANCSSMS  180
SVNKNFIPTS TVLRNSCPLR EFVPSVKETI NKDTSKPSNL ENSCTSYEKP AQVQRKDDMD  240
GAICTDEMQA THNNPQHVAV HVLDGSPGTC APNPSMDITF QDSIFHPMGD IHGQVNLFAN  300
PAASATTAHQ NNAPRSTHQA FPTFHTPFMH LQPNQEDYRS FLHVSSAFSS LVVSTLLQNP  360
AAHAAASFAA TFWPYANVQN SDDSPACDQE GFPSRQMNSA TGMAAIAAAT AWWAAHGLLS  420
VCAPLQTGCT CAPASTATVT PMENGEAPAA KMERKMYAGQ DPSMQDQRLD PQYAEAMQCQ  480
RSASKSPTSS SDREESGEAK ANTEVKATAV TEPQDPNKTK NGKQVDRSSC GSNTPSSSDV  540
EMDVLEKNKE DKEQKEDSKA ADANHPQVEC SNRRGRSSTN LSDSWKEVSE GGRLAFQALF  600
SREVLPQSFS PPHDRENTEK QKGSVGADEQ NPDQNNGETS VLHFSSEACR SCSDNQGVEK  660
KALSKAKNIV DESLLTIGLG HEKLKARQTG FKPYKRCSVE AKESRVMNTG SQGEEKDPKR  720
IRLEGEALT*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
194100RPKRKPR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00654PBMTransfer from LOC_Os08g06110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012490194.10.0PREDICTED: protein LHY-like isoform X1
TrEMBLA0A0D2QQW90.0A0A0D2QQW9_G
STRINGVIT_15s0048g02410.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM55762645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.31e-131MYB_related family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]